Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004189-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004189-M09, RRID:AB_1674218
- Product name
- DNAJB9 monoclonal antibody (M09), clone 3G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DNAJB9.
- Antigen sequence
NFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGG
SSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFD
STNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYT
DCSGQ- Isotype
- IgG
- Antibody clone number
- 3G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The unfolded protein response governs integrity of the haematopoietic stem-cell pool during stress.
van Galen P, Kreso A, Mbong N, Kent DG, Fitzmaurice T, Chambers JE, Xie S, Laurenti E, Hermans K, Eppert K, Marciniak SJ, Goodall JC, Green AR, Wouters BG, Wienholds E, Dick JE
Nature 2014 Jun 12;510(7504):268-72
Nature 2014 Jun 12;510(7504):268-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DNAJB9 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DNAJB9 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
