HPA023560

TRIM8 antibody from Sigma-Aldrich
GERP, RNF27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023560
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023560, RRID:AB_10600414
Product name
Anti-TRIM8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023560
Antibody type
Polyclonal
Antigen
tripartite motif-containing 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSVDNCYCSSVANHGGHQPYPRSGHFPWTVPSQEY
SHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFY
RVYGQPSTKHYVTS
Storage
-20C
Provider Type Product Number
- No reagents -