H00008655-M02

DYNLL1 antibody from Abnova Corporation
DLC1, DLC8, DNCL1, hdlc1, LC8, PIN

Antibody data

Product number
H00008655-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008655-M02, RRID:AB_1137179
Product name
DYNLL1 monoclonal antibody (M02), clone 1H7
Provider product page
Abnova Corporation - H00008655-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DYNLL1.
Antigen sequence
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIE
KDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET
KH
Isotype
IgG
Antibody clone number
1H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -