ABIN406163

DYNLL1 antibody from antibodies-online
DLC1, DLC8, DNCL1, hdlc1, LC8, PIN

Antibody data

Product number
ABIN406163
Provider
antibodies-online
Product name
anti-Dynein, Light Chain, LC8-Type 1 (DYNLL1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406163
Antibody type
Polyclonal
Antigen
The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
Host
Rabbit
Antigen sequence
EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHE
TKHFI YFYLGQVAIL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -