Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406163 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dynein, Light Chain, LC8-Type 1 (DYNLL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHE
TKHFI YFYLGQVAIL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Serine 88 phosphorylation of the 8-kDa dynein light chain 1 is a molecular switch for its dimerization status and functions.
Song C, Wen W, Rayala SK, Chen M, Ma J, Zhang M, Kumar R
The Journal of biological chemistry 2008 Feb 15;283(7):4004-13
The Journal of biological chemistry 2008 Feb 15;283(7):4004-13
No comments: Submit comment
No validations: Submit validation data