ABIN567175

GJB3 antibody from antibodies-online
CX31, DFNA2, EKV

Antibody data

Product number
ABIN567175
Provider
antibodies-online
Product name
anti-Gap Junction Protein, beta 3, 31kDa (GJB3) (N-Term) antibody
Provider product page
antibodies-online - ABIN567175
Antibody type
Polyclonal
Antigen
The immunogen for anti-Gjb3 antibody: synthetic peptide corresponding to a region of Mouse
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLV
YVVAA ERVWGDEQKD
Vial size
50 µg
Provider Type Product Number
- No reagents -