HPA030259

RTKN antibody from MilliporeSigma / Merck KGaA
B5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030259
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030259, RRID:AB_10601484
Product name
Anti-RTKN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030259
Antibody type
Polyclonal
Antigen
rhotekin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFC
YRQPEDADTGEEPLLTIAVNKETRVRAGELDQALG
RPFTLSISNQYGDDEVTHTLQTESREALQSWMEAL
WQLFFDMSQWKQCC
Storage
-20C
Provider Type Product Number
- No reagents -