HPA014561

TMEM30A antibody from Sigma-Aldrich
C6orf67, CDC50A, FLJ10856
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014561
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014561, RRID:AB_10601823
Product name
Anti-TMEM30A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014561
Antibody type
Polyclonal
Antigen
transmembrane protein 30A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIA
PCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGI
AWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKP
VYMLDSDPDNNGFI
Storage
-20C
Provider Type Product Number
- No reagents -