HPA017924

PDCD11 antibody from Sigma-Aldrich
ALG-4, KIAA0185, RRP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017924, RRID:AB_10601045
Product name
Anti-PDCD11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017924
Antibody type
Polyclonal
Antigen
programmed cell death 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKI
GTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTAD
NVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQ
LLRGYVGSIQPHG
Storage
-20C
Provider Type Product Number
- No reagents -