Antibody data

Product number
H00010376-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010376-M12, RRID:AB_1581593
Product name
TUBA1B monoclonal antibody (M12), clone 2E8
Provider product page
Abnova Corporation - H00010376-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TUBA1B.
Antigen sequence
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQ
MPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL
EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYAR
GHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP
QVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
DICRRNLDIERPTYTNLSRLISQIVSSITASLRFD
GALNVDLAEFQTNLVPYPRIHFPLATYAPVISAEK
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMAC
CLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIA
EAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Isotype
IgG
Antibody clone number
2E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -