HPA062618

DENND6A antibody from Atlas Antibodies
AFI1A, FAM116A, FLJ34969

Antibody data

Product number
HPA062618
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062618, RRID:AB_2684809
Product name
Anti-DENND6A
Provider product page
Atlas Antibodies - HPA062618
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHI
DAIILALPEDLQGILL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.