Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309858 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Meis Homeobox 1 (MEIS1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the C terminal of human MEIS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMS
GMGMN MGMEGQWHYM- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome.
Robinson BW, Cheung NK, Kolaris CP, Jhanwar SC, Choi JK, Osheroff N, Felix CA
Blood 2008 Apr 1;111(7):3802-12
Blood 2008 Apr 1;111(7):3802-12
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting