Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055023-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055023-M01, RRID:AB_530173
- Product name
- PHIP monoclonal antibody (M01), clone 4D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PHIP.
- Antigen sequence
TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSK
LVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQY
AKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKE
DL- Isotype
- IgG
- Antibody clone number
- 4D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pleckstrin homology domain-interacting protein (PHIP) as a marker and mediator of melanoma metastasis.
De Semir D, Nosrati M, Bezrookove V, Dar AA, Federman S, Bienvenu G, Venna S, Rangel J, Climent J, Meyer Tamgüney TM, Thummala S, Tong S, Leong SP, Haqq C, Billings P, Miller JR 3rd, Sagebiel RW, Debs R, Kashani-Sabet M
Proceedings of the National Academy of Sciences of the United States of America 2012 May 1;109(18):7067-72
Proceedings of the National Academy of Sciences of the United States of America 2012 May 1;109(18):7067-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PHIP is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PHIP on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol