Antibody data

Product number
H00339488-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00339488-B01, RRID:AB_1139001
Product name
TFAP2E MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00339488-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TFAP2E protein.
Antigen sequence
MERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPA
ATAAAEFQPPYFPPPYPQPPLPYGQAPDAAAAFPH
LAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEP
PGLLAPPARALGLDPRRDYATAVPRLLHGLADGAH
GLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQS
VIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVF
CSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNA
SLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRR
KAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKA
AAEYLCRQHADPGELHSRKSMLLAAKQICKEFADL
MAQDRSPLGNSRPALILEPGVQSCLTHFSLITHGF
GGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGH
GETKASEKDAKHRK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -