Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311575 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Leber Congenital Amaurosis 5 (LCA5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LCA5 antibody: synthetic peptide directed towards the N terminal of human LCA5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDT
ERRIK ELSKNLELST- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of a novel splice-site mutation in the Lebercilin (LCA5) gene causing Leber congenital amaurosis.
Transplantation of a sheet of human corneal endothelial cell in a rabbit model.
Ramprasad VL, Soumittra N, Nancarrow D, Sen P, McKibbin M, Williams GA, Arokiasamy T, Lakshmipathy P, Inglehearn CF, Kumaramanickavel G
Molecular vision 2008 Mar 10;14:481-6
Molecular vision 2008 Mar 10;14:481-6
Transplantation of a sheet of human corneal endothelial cell in a rabbit model.
Hitani K, Yokoo S, Honda N, Usui T, Yamagami S, Amano S
Molecular vision 2008 Jan 3;14:1-9
Molecular vision 2008 Jan 3;14:1-9
No comments: Submit comment
No validations: Submit validation data