HPA029525

VSTM5 antibody from MilliporeSigma / Merck KGaA
C11orf90, LOC387804
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029525
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029525, RRID:AB_10600789
Product name
Anti-C11orf90 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029525
Antibody type
Polyclonal
Antigen
Uncharacterized protein C11orf90 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVSLYIPQATINATVKEDILLSVEYSCHGVPTIEW
TYSSNWGTQKIVEWKPGTQANISQSHKDRVCTFDN
GSIQLFSVGVRDSGYYVITVTERLGSSQFGTIVLH
VSEILYEDLH
Storage
-20C
Provider Type Product Number
- No reagents -