HPA003354

ZNF74 antibody from Sigma-Aldrich
Cos52, Zfp520, ZNF520
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003354
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003354, RRID:AB_1080747
Product name
Anti-ZNF74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003354
Antibody type
Polyclonal
Antigen
Zinc finger protein 74 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKC
SECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMF
NWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPG
SLLGAGDAGLRDVDPIDALDVAKLLCVVP
Storage
-20C
Provider Type Product Number
- No reagents -