SAB2102950

ZNF74 antibody from Sigma-Aldrich
Cos52, Zfp520, ZNF520
No application information provided.

Antibody data

Product number
SAB2102950
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102950, RRID:AB_10605538
Product name
Anti-ZNF74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102950
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_003417.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVC
GECGKAFRQSSSLTL
Storage
-20C
Provider Type Product Number
- No reagents -