Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009446-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009446-A01, RRID:AB_463719
- Product name
- GSTO1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GSTO1.
- Antigen sequence
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEE
VLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLN
ECVDHTPKLKLWMAAMKED- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Identification of platinum-resistance associated proteins through proteomic analysis of human ovarian cancer cells and their platinum-resistant sublines.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Identification of platinum-resistance associated proteins through proteomic analysis of human ovarian cancer cells and their platinum-resistant sublines.
Yan XD, Pan LY, Yuan Y, Lang JH, Mao N
Journal of proteome research 2007 Feb;6(2):772-80
Journal of proteome research 2007 Feb;6(2):772-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GSTO1 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of GSTO1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GSTO1 expression in transfected 293T cell line by GSTO1 polyclonal antibody (A01).Lane1:GSTO1 transfected lysate(27.566 KDa).Lane2:Non-transfected lysate.