Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504548 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Eukaryotic Translation Initiation Factor 2C3 (EIF2C3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EIF2C3 antibody: synthetic peptide directed towards the N terminal of human EIF2C3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
- MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVE
 VTHCG TMRRKYRVCN
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Identification of eight members of the Argonaute family in the human genome.
				
		
	
			Sasaki T, Shiohama A, Minoshima S, Shimizu N
Genomics 2003 Sep;82(3):323-30
		Genomics 2003 Sep;82(3):323-30
				No comments: Submit comment	
	
			
			No validations: Submit validation data