H00003742-B01P

KCNA6 antibody from Abnova Corporation
HBK2, Kv1.6, PPP1R96
No application information provided.

Antibody data

Product number
H00003742-B01P
Provider
Abnova Corporation
Product name
KCNA6 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00003742-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KCNA6 protein.
Antigen sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGG
GCCSSERLVINISGLRFETQLRTLSLFPDTLLGDP
GRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LRRPVNVPLDIFLEEIRFYQLGDEALAAFREDEGC
LPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARG
IAIVSVLVILISIVIFCLETLPQFRVDGRGGNNGG
VSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGT
GGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLV
RFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTEL
VQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVF
RIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFI
GVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVP
VIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLR
ATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRM
LTEV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.