Antibody data

Product number
ABIN406385
Provider
antibodies-online
Product name
anti-Hexokinase 2 (HK2) (N-Term) antibody
Provider product page
antibodies-online - ABIN406385
Antibody type
Polyclonal
Antigen
The immunogen for anti-HK2 antibody: synthetic peptide directed towards the N terminal of human HK2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus
Host
Rabbit
Antigen sequence
GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEME
NQIYA IPEDIMRGSG
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -