HPA010087

GNA13 antibody from Sigma-Aldrich
G13, MGC46138
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010087, RRID:AB_10601478
Product name
Anti-GNA13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010087
Antibody type
Polyclonal
Antigen
guanine nucleotide binding protein (G protein), alpha 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKL
HIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRV
FLQYLPAIRALWADSGIQNAYDRRREFQLGES
Storage
-20C
Provider Type Product Number
- No reagents -