Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056655-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056655-A01, RRID:AB_606804
- Product name
- POLE4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant POLE4.
- Antigen sequence
TSVPGARLSRLPLARVKALVKADPDVTLAGQEAIF
ILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
NAIEAVDEFAFLEGTLD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Polymerase ε1 mutation in a human syndrome with facial dysmorphism, immunodeficiency, livedo, and short stature ("FILS syndrome").
Pachlopnik Schmid J, Lemoine R, Nehme N, Cormier-Daire V, Revy P, Debeurme F, Debré M, Nitschke P, Bole-Feysot C, Legeai-Mallet L, Lim A, de Villartay JP, Picard C, Durandy A, Fischer A, de Saint Basile G
The Journal of experimental medicine 2012 Dec 17;209(13):2323-30
The Journal of experimental medicine 2012 Dec 17;209(13):2323-30
No comments: Submit comment
No validations: Submit validation data