HPA030420

XPNPEP1 antibody from MilliporeSigma / Merck KGaA
XPNPEP, XPNPEPL, XPNPEPL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030420
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030420, RRID:AB_10611523
Product name
Anti-XPNPEP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030420
Antibody type
Polyclonal
Antigen
X-prolyl aminopeptidase (aminopeptidase P) 1, soluble recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLT
LVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGK
ELQKQGRQEALEWLIRETQPISKQH
Storage
-20C
Provider Type Product Number
- No reagents -