Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15739 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15739, RRID:AB_10679168
- Product name
- Mtap7d1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Mtap7d1.
- Antigen sequence
PTAAPSVTPSKPMAGTTDREEATRLLAEKRRQARE
QREREEQERKLQAERDKRMREEQLAREAEARAERE
AEARRREEQEAREKAQAEQEEQERLQKQKEEAEAR
SREEAERQRQEREKHFQKEEQERQERRKRLEEIMK
RTRKSEAAETKVRILRLGSGSWGEERRLQRSLQSR
GRIQ- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
No comments: Submit comment
No validations: Submit validation data