HPA028075

MAP7D1 antibody from Sigma-Aldrich
FLJ10350, FLJ39022, PARCC1, RPRC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028075
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028075, RRID:AB_10603778
Product name
Anti-MAP7D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028075
Antibody type
Polyclonal
Antigen
MAP7 domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPVKAVEARSPGLQKEAVQKEEPIPQEPQWSLPSK
ELPASLVNGLQPLPAHQENGFSTNGPSGDKSLSRT
PETLLPFAEAEAFLKKAVVQSPQVTEVL
Storage
-20C
Provider Type Product Number
- No reagents -