H00009801-B01P

MRPL19 antibody from Abnova Corporation
KIAA0104, MRP-L15, RLX1, RPML15

Antibody data

Product number
H00009801-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009801-B01P, RRID:AB_1577425
Product name
MRPL19 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009801-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPL19 protein.
Antigen sequence
MAACIAAGHWAAMGLGRSFQAARTLLPPPASIACR
VHAGPVRQQSTGPSEPGAFQPPPKPVIVDKHRPVE
PERRFLSPEFIPRRGRTDPLKFQIERKDMLERRKV
LHIPEFYVGSILRVTTADPYASGKISQFLGICIQR
SGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQ
VVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQE
PNQKVPVNELRVKMKPKPWSKRWERPNFNIKGIRF
DLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEA
AIWKEIEASKRS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -