ABIN406658

GCFC2 antibody from antibodies-online
C2orf3, DNABF, GCF, TCF9
Western blot
Data presented on provider website

Antibody data

Product number
ABIN406658
Provider
antibodies-online
Product name
anti-GC-Rich Sequence DNA-Binding Factor 2 (GCFC2) (N-Term) antibody
Provider product page
antibodies-online - ABIN406658
Antibody type
Polyclonal
Antigen
The immunogen for anti-C2orf3 antibody: synthetic peptide directed towards the N terminal of human C2orf3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETS
EESQE DEKQDTWEQQ
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.