Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406658 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-GC-Rich Sequence DNA-Binding Factor 2 (GCFC2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C2orf3 antibody: synthetic peptide directed towards the N terminal of human C2orf3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETS
EESQE DEKQDTWEQQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A locus on 2p12 containing the co-regulated MRPL19 and C2ORF3 genes is associated to dyslexia.
Anthoni H, Zucchelli M, Matsson H, Müller-Myhsok B, Fransson I, Schumacher J, Massinen S, Onkamo P, Warnke A, Griesemann H, Hoffmann P, Nopola-Hemmi J, Lyytinen H, Schulte-Körne G, Kere J, Nöthen MM, Peyrard-Janvid M
Human molecular genetics 2007 Mar 15;16(6):667-77
Human molecular genetics 2007 Mar 15;16(6):667-77
No comments: Submit comment
No validations: Submit validation data