SAB2100296

GCFC2 antibody from MilliporeSigma / Merck KGaA
C2orf3, DNABF, GCF, TCF9
No application information provided.

Antibody data

Product number
SAB2100296
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-C2ORF3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100296
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_003194.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETS
EESQEDEKQDTWEQQ
Storage
-20C