HPA027904

DOP1A antibody from Sigma-Aldrich
dJ202D23.2, DOPEY1, KIAA1117
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027904
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027904, RRID:AB_10600877
Product name
Anti-DOPEY1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027904
Antibody type
Polyclonal
Antigen
dopey family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLLLHPKTQRVSVQRVQAERYWNKSPCYPGEESD
KHFMQNFACSNVSQVQLITSKGNGEKPLTMDEIEN
FSLTVNPLSDRLSLLSTSSETIPMVVSDFD
Storage
-20C
Provider Type Product Number
- No reagents -