Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406250 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Family with Sequence Similarity 76, Member B (FAM76B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FAM76B antibody: synthetic peptide directed towards the middle region of human FAM76B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKT
KEQRK SLGSSHSNSS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
Vasilescu J, Zweitzig DR, Denis NJ, Smith JC, Ethier M, Haines DS, Figeys D
Journal of proteome research 2007 Jan;6(1):298-305
Journal of proteome research 2007 Jan;6(1):298-305
No comments: Submit comment
No validations: Submit validation data