Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008898-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008898-M03, RRID:AB_518934
- Product name
- MTMR2 monoclonal antibody (M03), clone 4G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTMR2.
- Antigen sequence
SSCESLGSQPAAARPPSVDSLSSASTSHSENSVHT
KSASVVSSDSISTSADNFSPDLRVLRESNKLAEME
EPPLLPGENIKDMAKDVTYICPFTGA- Isotype
- IgG
- Antibody clone number
- 4G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dlg1, Sec8, and Mtmr2 regulate membrane homeostasis in Schwann cell myelination.
Bolis A, Coviello S, Visigalli I, Taveggia C, Bachi A, Chishti AH, Hanada T, Quattrini A, Previtali SC, Biffi A, Bolino A
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Jul 8;29(27):8858-70
The Journal of neuroscience : the official journal of the Society for Neuroscience 2009 Jul 8;29(27):8858-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MTMR2 expression in transfected 293T cell line by MTMR2 monoclonal antibody (M03), clone 4G6.Lane 1: MTMR2 transfected lysate(66 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MTMR2 monoclonal antibody (M03), clone 4G6. Western Blot analysis of MTMR2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTMR2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol