Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487256 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Ankyrin Repeat Domain 7 (ANKRD7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANKRD7 antibody: synthetic peptide directed towards the middle region of human ANKRD7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
- EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEK
 GADVN ASDNYQRTAL
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Isolation of three testis-specific genes (TSA303, TSA806, TSA903) by a differential mRNA display method.
				
		
	
			Ozaki K, Kuroki T, Hayashi S, Nakamura Y
Genomics 1996 Sep 1;36(2):316-9
		Genomics 1996 Sep 1;36(2):316-9
				No comments: Submit comment	
	
			
			No validations: Submit validation data