HPA026853

SMARCC1 antibody from Sigma-Aldrich
BAF155, CRACC1, Rsc8, SRG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026853, RRID:AB_10603030
Product name
Anti-SMARCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026853
Antibody type
Polyclonal
Antigen
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEP
EKLEGAEEEKMEADPDGQQPEKAENKVENETDEGD
KAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALA
SAATKAKHL
Storage
-20C
Provider Type Product Number
- No reagents -