Antibody data

Product number
H00131177-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00131177-B02P, RRID:AB_1573480
Product name
FAM3D purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00131177-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM3D protein.
Antigen sequence
MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIR
LPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKI
CSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIAL
VNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGA
LVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGF
RDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWP
ELLEMEGCMPPKPF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -