H00127700-B01P

OSCP1 antibody from Abnova Corporation
C1orf102, NOR1
No application information provided.

Antibody data

Product number
H00127700-B01P
Provider
Abnova Corporation
Product name
C1orf102 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00127700-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C1orf102 protein.
Antigen sequence
MSVRTLPLLFLNLGGEMLYILDQRLRAQNIRGDKA
RKVLNDIISTMFNRKFMEELFKPQELYSKKALRTV
YERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLC
PRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETL
RQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSM
FLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFN
NKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLK
LGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNP
LAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTT
DEEEEQAALTRPEELSYEVINIQATQDQQRSEELA
RIMGEFEITEQPRLSTGKGDDLLAMMDEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.