Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009931-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009931-M02, RRID:AB_875615
- Product name
- HELZ monoclonal antibody (M02), clone 5B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HELZ.
- Antigen sequence
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLS
LGQYSMADFTGPCPLEIERIKIESLLYRIASFLQL
KNYVQADEDCRHVLGEGLAKGEDAFRAVLC- Isotype
- IgG
- Antibody clone number
- 5B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The putative RNA helicase HELZ promotes cell proliferation, translation initiation and ribosomal protein S6 phosphorylation.
Hasgall PA, Hoogewijs D, Faza MB, Panse VG, Wenger RH, Camenisch G
PloS one 2011;6(7):e22107
PloS one 2011;6(7):e22107
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HELZ monoclonal antibody (M02), clone 5B2 Western Blot analysis of HELZ expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HELZ is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HELZ on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HELZ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
