HPA028276

HELZ antibody from Sigma-Aldrich
DHRC, HUMORF5, KIAA0054
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028276
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028276, RRID:AB_10601814
Product name
Anti-HELZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028276
Antibody type
Polyclonal
Antigen
helicase with zinc finger recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAF
NTEIFGTFRQTIVFDFGLEPVLMQRVMIDAASTED
LEYLMHAKQQLVTTAKRWDSSSKTIIDFEPNETTD
LEKSLLIRYQIPLSADQLFTQSVLDKSLTKSNYQS
RL
Storage
-20C
Provider Type Product Number
- No reagents -