HPA028134

MRPS15 antibody from Sigma-Aldrich
FLJ11564
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028134, RRID:AB_10600890
Product name
Anti-MRPS15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028134
Antibody type
Polyclonal
Antigen
mitochondrial ribosomal protein S15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDD
DPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
KE
Storage
-20C
Provider Type Product Number
- No reagents -