Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29429 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FAM3C polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human FAM3C.
- Antigen sequence
KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVL
MGTYDDGATKLNDEARRLIADLGSTSITNLGFRDN
WVFCG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Human cell line RT-4 with FAM3C polyclonal antibody (Cat # PAB29429) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with FAM3C polyclonal antibody (Cat # PAB29429) at 1-4 ug/mL concentration shows positivity in the Golgi apparatus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus with FAM3C polyclonal antibody (Cat # PAB29429) shows strong granular cytoplasmic positivity in neurons at 1:1000-1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)