H00083743-B01

GRWD1 antibody from Abnova Corporation
GRWD, RRB1, WDR28

Antibody data

Product number
H00083743-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083743-B01, RRID:AB_1139111
Product name
GRWD1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00083743-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GRWD1 protein.
Antigen sequence
MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLP
GRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFD
IVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMM
LRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQ
LELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQV
EVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSF
AGHMGEGFALDWSPRVTGRLLTGDCQKNIHLWTPT
DGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASC
SADASIRIWDIRAAPSKACMLTTATAHDGDVNVIS
WSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFK
QHVAPVTSVEWHPQDSGVFAASGADHQITQWDLAV
ERDPEAGDVEADPGLADLPQQLLFVHQGETELKEL
HWHPQCPGLLVSTALSGFTIFRTISV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -