HPA030171

CEP162 antibody from Atlas Antibodies
C6orf84, KIAA1009, QN1

Antibody data

Product number
HPA030171
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030171, RRID:AB_10601567
Product name
Anti-CEP162
Provider product page
Atlas Antibodies - HPA030171
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NISTMESDLPTVEELMKPIRIDSFGISGFDLQPVS
SEKVAERKETEFFSSLPLKMNPNILSQDSQHVNLF
FDKNDENVILQKTTNESMENSCPQVTEVTATEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.