PAB22409

CEP162 antibody from Abnova Corporation
C6orf84, KIAA1009, QN1

Antibody data

Product number
PAB22409
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22409, RRID:AB_10965128
Product name
KIAA1009 polyclonal antibody
Provider product page
Abnova Corporation - PAB22409
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KIAA1009.
Antigen sequence
NISTMESDLPTVEELMKPIRIDSFGISGFDLQPVS
SEKVAERKETEFFSSLPLKMNPNILSQDSQHVNLF
FDKNDENVILQKTTNESMENSCPQVTEVTATEE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.