HPA030171

CEP162 antibody from MilliporeSigma / Merck KGaA
C6orf84, KIAA1009, QN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030171
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030171, RRID:AB_10601567
Product name
Anti-KIAA1009 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030171
Antibody type
Polyclonal
Antigen
KIAA1009 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NISTMESDLPTVEELMKPIRIDSFGISGFDLQPVS
SEKVAERKETEFFSSLPLKMNPNILSQDSQHVNLF
FDKNDENVILQKTTNESMENSCPQVTEVTATEE
Storage
-20C
Provider Type Product Number
- No reagents -