H00023457-M01

ABCB9 antibody from Abnova Corporation
EST122234

Antibody data

Product number
H00023457-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023457-M01, RRID:AB_1137078
Product name
ABCB9 monoclonal antibody (M01), clone 4F4
Provider product page
Abnova Corporation - H00023457-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ABCB9.
Antigen sequence
FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTR
PHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNI
LENFYPLEGGRVLLDGKPISAYDHKYLHR
Isotype
IgG
Antibody clone number
4F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -