H00079676-B01P

OGFOD2 antibody from Abnova Corporation
FLJ13491, FLJ37501

Antibody data

Product number
H00079676-B01P
Provider
Abnova Corporation
Product name
OGFOD2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079676-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OGFOD2 protein.
Antigen sequence
MVELEQEVERRQRLGQESAARKALIASSYHPARPE
VYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRL
ETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDM
PKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQP
LMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCH
YDNAELTLNVALGKVFTGGALYFGGLFQAPTALTE
PLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVV
WLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREE
PATVDVCALT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.