H00079676-B01

OGFOD2 antibody from Abnova Corporation
FLJ13491, FLJ37501

Antibody data

Product number
H00079676-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079676-B01, RRID:AB_1204354
Product name
FLJ13491 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079676-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FLJ13491 protein.
Antigen sequence
MVELEQEVERRQRLGQESAARKALIASSYHPARPE
VYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRL
ETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDM
PKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQP
LMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCH
YDNAELTLNVALGKVFTGGALYFGGLFQAPTALTE
PLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVV
WLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREE
PATVDVCALT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -