HPA023036

C17orf58 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023036, RRID:AB_10601144
Product name
Anti-C17orf58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023036
Antibody type
Polyclonal
Antigen
UPF0450 protein C17orf58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHK
RRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNR
KREGQIQGAIH
Storage
-20C
Provider Type Product Number
- No reagents -