HPA027163

GNL2 antibody from Sigma-Aldrich
HUMAUANTIG, Ngp-1, Nog2, Nug2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027163
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027163, RRID:AB_10601655
Product name
Anti-GNL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027163
Antibody type
Polyclonal
Antigen
guanine nucleotide binding protein-like 2 (nucleolar) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNN
PGEEVTETAGEGSESIIKEETEENSHCDANTEMQQ
ILTRVRQNFGKINVVPQFSGDDLVPV
Storage
-20C
Provider Type Product Number
- No reagents -