Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051329-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051329-M09, RRID:AB_529963
- Product name
- ARL6IP4 monoclonal antibody (M09), clone 5E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARL6IP4.
- Antigen sequence
PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPM
TKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEE
IVTKERHREINKQATRGDCLAFQMRAGLLP- Isotype
- IgG
- Antibody clone number
- 5E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SRrp37, a novel splicing regulator located in the nuclear speckles and nucleoli, interacts with SC35 and modulates alternative pre-mRNA splicing in vivo.
Ouyang P
Journal of cellular biochemistry 2009 Sep 1;108(1):304-14
Journal of cellular biochemistry 2009 Sep 1;108(1):304-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARL6IP4 monoclonal antibody (M09), clone 5E5 Western Blot analysis of ARL6IP4 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARL6IP4 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ARL6IP4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ARL6IP4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol